DPCstruct | MC25642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0VGD1 | 448-543 | ALRRGVELLRGLDFGPPIFALMTMLGVKGLAMGRENAYNDLCAESDPFDRDDLLLPDVAVQDFADDAPAVLKPAFDTMWQAAGKPGS… |
| A0A522SP79 | 1-95 | MRSYQQALPDLGLAAPAYIFFSLLGVTGCVLAGDNRFTRRAYYADRDALILPELLVEDWSIESAEAMRPLFDMVWNAFGYERSFNYD… |
| A0A0F9CZW0 | 1-109 | None |
| A0A5E4IH66 | 197-290 | None |
| A0A0W0RQM4 | 29-114 | None |
| A0A1H9GTB2 | 25-126 | None |
| A0A5C8AUC9 | 175-273 | None |
| A0A2V9N2E6 | 91-184 | None |
| A0A843AQU4 | 403-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.