DPCstruct | MC25641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 152 ± 29 aa |
| Standard deviation of domain lengths | 29.00 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 22.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9N256 | 86-249 | RATIEKALSPLPMDLRADATVYTYDDAGNRVTLKAGSNHVECQPTDEEGFTRCGPVSQRARRDLQANLSAQGMEGDDLQLALQKAED… |
| A0A522NC91 | 18-173 | DAQLIKSAMRAAPAHVAKDATIVAMDANGKMRTLRQGTNDFTCMPDSPATPGPDPMCMDRNALEWANAWMAHQHPPVGKLGLMYMLE… |
| A0A2T0N597 | 12-163 | None |
| A0A2V9XWN6 | 38-238 | None |
| A0A5S3PRK4 | 6-136 | None |
| A0A651HMF3 | 63-239 | None |
| A0A6I4V802 | 12-186 | None |
| A0A2E8EAS2 | 46-179 | None |
| R1E3E8 | 3-92 | None |
| A0A2E9NPL1 | 3-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.