DPCstruct | MC25639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 389 ± 65 aa |
| Standard deviation of domain lengths | 64.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A846DES7 | 3-288 | TISASNVSGESQDISLENLETLEVNNSNISASTVDGTAGSINVNANESVQLTGEGGLNVAATGFGTAGTINVNTPQITIQDGAKISA… |
| A0A1Z4N1H5 | 1-463 | MQEGSAIITVTYETANSGNIQIQSADIELSGFSLLNPVGVTSITTSTNGKGVAGDILINGNNLLISGGASLSSVTLGSGSTGQVMIR… |
| A0A3C0I5K7 | 306-731 | None |
| A0A1V1P5S5 | 340-689 | None |
| A0A3D4XTB6 | 1-374 | None |
| A0A6P1KLA2 | 181-602 | None |
| A0A7V9DZL5 | 19-319 | None |
| A0A6I5Q8C8 | 1-353 | None |
| A0A845ZPM3 | 1-444 | None |
| A0A2H2XVU1 | 2-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.