DPCstruct | MC25634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2Z1R2 | 272-392 | QRKLKVVQAEQNIHLFLNMHALKVEKQGDRIVAVIAQDIQKGTQSRFTAPLFADCTGDGTVGFLAGADFRMGRESKAETGEPLAPEE… |
| A0A1W9JSY7 | 1-108 | MFLQHRIVAAARGGASIVSIDTVTARGGHARRFRARMFVDASGTAALGVLSGADTMFGREARANYNEPYAPEVADDMHHGNTLFFRT… |
| A0A4P5QJX9 | 61-176 | None |
| A0A7X6ZGK9 | 33-154 | None |
| A0A3D2D2J7 | 93-210 | None |
| A0A6C0FPW1 | 5-99 | None |
| A0A017SIC3 | 21-150 | None |
| A0A4Z0ZAL6 | 220-334 | None |
| A0A3C0WZZ1 | 68-188 | None |
| A0A0G4H267 | 5-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.