DPCstruct | MC25633
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 123 ± 18 aa |
| Standard deviation of domain lengths | 17.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15637 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H1LTB0 | 29-154 | RHNESLKVEMQYLGRGNSNANSQGWERNSAKYFDSLYQNHPEMFSKKNAARVKDGHAPIVDAKMIAHNPGWAQYRNQPLVHHHIGGD… |
| A0A4U3ARW7 | 6-153 | RTYRGVELQNIDPVYIADQRTVVEMPFVGKGEKYTNAEGWRRDLKYFWSELLDRHPEAFSPNNRAIIEGRNPFTDSPVNDKVFREYF… |
| A0A0N0GCF9 | 646-750 | None |
| C2FUY5 | 440-529 | None |
| H3SNR9 | 34-176 | None |
| A0A5B0DIY3 | 273-423 | None |
| A0A7V8ZYS2 | 1-103 | None |
| A0A2T4HEN5 | 50-159 | None |
| A0A7W7YG98 | 136-232 | None |
| A0A1E8B5S7 | 216-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.