DPCstruct | MC25632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 462 ± 53 aa |
| Standard deviation of domain lengths | 52.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V0US65 | 5-425 | AEDSKKDEMTPKHTRQKREVEEVMDTDDDGIYDSWEREGYTVINRVVVKWDQEKHKPLGYTKFVSDPNDAHTAGDPYTDYEKAAGII… |
| A0A4U2NJP7 | 1-520 | MYNSKTANQLLEKDQQTYQSIRWIGFIKSDETGNFTFKLSDDEHAVIEIDEKVVSNQGKEKQSVHVEKDKLVPIKIEYRSNAPLQSD… |
| A0A3D3T270 | 34-435 | None |
| A0A2H3Q3X4 | 482-923 | None |
| J7XH06 | 68-555 | None |
| A0A2B7F2D5 | 70-456 | None |
| A0A7X2E4X0 | 67-516 | None |
| A4BAV7 | 30-456 | None |
| A0A377Q5K1 | 282-741 | None |
| C2Q554 | 27-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.