DPCstruct | MC25630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 32 aa |
| Standard deviation of domain lengths | 32.05 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 68.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 50.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7F1G4 | 6-165 | SKKIILSLLLLATISLYVSFVFNSCVISSLSKAIPKWQTHPVIVNEIPLVHYTSSVRVVSLLEGNETDISPKYKFFREQGLRPERQL… |
| A0A7J7EER8 | 33-156 | CLRGPSAGGQKLLQKSRPCDLPGPTPGEPSAPGAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRVHPDVR… |
| A0A662Z346 | 14-215 | None |
| A0A7F8R0U7 | 1-134 | None |
| A0A6B2EDG2 | 13-150 | None |
| A0A6P9B4W9 | 20-121 | None |
| A0A1A6GJZ1 | 97-199 | None |
| A0A835TPV7 | 42-125 | None |
| A0A060ZAE7 | 2-145 | None |
| A0A4V6ASS9 | 93-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.