DPCstruct | MC2563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 58 ± 1 aa |
| Standard deviation of domain lengths | 1.15 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 95.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672SVG1 | 23-80 | MILDFVIPQKGCSLLEAYERWRTTADPKVCCDYSLHMAVTWWDDTVKKEMETLVHEKG |
| A0A5B7HN18 | 28-85 | MIMDFAIPQKGESLVEAYHRWRSWADPKVCCDYALHVAVTWWSDKVGKEMEELTEEHG |
| A0A7J9DNN4 | 68-127 | None |
| A0A7R9E4I8 | 30-87 | None |
| S9WME1 | 178-233 | None |
| A0A060ZNP9 | 1-58 | None |
| A0A2G9PQ86 | 26-83 | None |
| A0A182SP62 | 78-133 | None |
| A0A6P7GZ53 | 140-197 | None |
| A0A7R9II99 | 198-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.