DPCstruct | MC25629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 134 ± 2 aa |
| Standard deviation of domain lengths | 2.02 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.07 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF08429- PF02928 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4KRK7 | 1-130 | MMNALKMRAESYNEWASNVNEALEAKVNNKRSLINFKALIEESEMKKFPDNDLLRHLRLVTQDADKCASVAQQLLNGKRQTRYRSGG… |
| B3KM92 | 103-237 | YRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKINKKKSLVSFKALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNG… |
| A0A182G1I6 | 629-762 | None |
| Q9VMJ7 | 872-1005 | None |
| A0A6A0H5G7 | 292-424 | None |
| A0A480ZJL9 | 335-469 | None |
| B4Q455 | 125-258 | None |
| A0A0N0PDQ2 | 3-134 | None |
| A0A0S7EWX7 | 22-158 | None |
| A0A0S7F2H8 | 22-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.