DPCstruct | MC25626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 2 aa |
| Standard deviation of domain lengths | 2.10 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 81.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6DX46 | 486-569 | MMVGLPASGKSTWAEKWVKEHQEKRYILLGTNLVLEQMKVPGLLRKNNYGERFERLMDYATWIFNKLLTRAANTPRNFIIDQTN |
| A0A0N4YIS2 | 165-245 | MMVGLPSVGKTTWVRRYIREHPSEHWTLISADTILASMKVNGVSRNSSHIGRWDMVLGLVGKARNRLLSLAARRRRNYILD |
| A0A067R624 | 214-300 | None |
| F2CZJ9 | 259-342 | None |
| A0A287JK43 | 183-264 | None |
| L5KJA8 | 357-441 | None |
| A0A2U1NN05 | 262-343 | None |
| A0A0K0DKC3 | 247-333 | None |
| A0A2G5EH31 | 216-299 | None |
| A0A1D6DX48 | 166-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.