DPCstruct | MC25623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 147 ± 35 aa |
| Standard deviation of domain lengths | 34.60 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3DQH0 | 44-151 | MNVEEMLASEVLGDFLGAVKNVWQPERLNAINITSALDRGGRVPLPINNMKEGVYVMVGADVPFSSCLREVESPHNQLRCSQEMEPV… |
| A0A6G0T0E5 | 41-174 | LNVEDMFHEERIPYLLDIFRQNLWLGSKQDLYVTFLASASDLGQRLPLDPNDTEGVVVNLGSSSNFSTILYDLEKEISPLQKMNKCP… |
| A0A1V4KBJ2 | 1-108 | None |
| B7PWL7 | 18-215 | None |
| A0A1B0BL98 | 130-294 | None |
| A0A6P7WRI6 | 1-108 | None |
| A0A232EZB0 | 134-311 | None |
| A0A7R8YNM7 | 730-907 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.