DPCstruct | MC25618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 150 ± 23 aa |
| Standard deviation of domain lengths | 23.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5VKA8 | 269-387 | YHASVDADGRVWVFPEASQAWSEFVAQGEPAAHVTKIGVGPNRETLKTRDAGVIEAYLVAQPGYVTQIADGRLWVIRADSDDLKEFT… |
| X7E170 | 1-162 | MNKSKLVIAMLLGGTLSACASLSSESSIASKFDVDGFKTELEDGRLWVFEEGSEELAFFKEHGEPAKQFTNIGAGPEGMTLKAASQE… |
| A0A2E3DQ26 | 1-138 | None |
| A0A1G2ZBV1 | 2-169 | None |
| A0A2N8KTP1 | 1-150 | None |
| A0A1Q3Y6T9 | 4-195 | None |
| A0A1V1X348 | 64-206 | None |
| A0A2S8GM67 | 145-271 | None |
| A0A5B9QYI2 | 207-328 | None |
| A0A6L3AH12 | 1-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.