DPCstruct | MC25608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 112 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05305 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8B4B9 | 2-94 | MIGTITAMLLATSAHADPAGDDANFLRSLDRLGITYQSPDSVIASGRAVCQLLDEGKTQKDIVQQLRQANPGFTLNSAKNFTVVAAT… |
| A0A498QQ13 | 18-133 | PFAARGASIGGLWDNPGVMRLLLLLAGVAAVVSVAAPARADDKQDQAFLVALGAAGITYQNADATIATGKKVCDMAKEGKSAIEVVA… |
| A0A557WWW1 | 13-118 | None |
| A0A081I8F2 | 109-220 | None |
| A0A1S1MX81 | 11-121 | None |
| A0A7I7P049 | 2-112 | None |
| A0A1B8SLE3 | 1-90 | None |
| A0A1V3WAU5 | 16-133 | None |
| A0A1X2DZW1 | 1-104 | None |
| A0A1Z4EMY6 | 94-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.