DPCstruct | MC25601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A359C636 | 4-96 | ISRDIGVRFTTGSPILMTHKIDPDVDEARVSLLQDLLASGFVQRFTVVGGVRRADFDHPRKNLTGDPYFTDGSRLVLFLSETSVPLD… |
| A0A432FN52 | 13-100 | SPIFFTHKIDPDVDEDRNYLIEDLLLTGQVTHLGYVEGLGKSTRDRPRANLTGDPYFTDGLRVVMFLGSHKEPLFHPRTRILEILDWD |
| A0A839WA52 | 271-359 | None |
| A0A5C7NMI1 | 314-391 | None |
| A0A1G3D3E6 | 181-288 | None |
| A0A0B0EHW4 | 1-83 | None |
| A0A2G2H2F1 | 174-242 | None |
| A0A7K4EUA1 | 1-92 | None |
| G8AXG9 | 274-365 | None |
| A0A7C7W2X4 | 336-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.