DPCstruct | MC25594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 9.35 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833MYS1 | 6-62 | GRTLQAMERVKAGIRAVVEHPFHVVKNLFGHRKVRYRGLAKNEAQLYTLFALANLVR |
| A0A7V9FGQ6 | 2-66 | TQRQRAVNRRRSQTRARGEHPFHVVKRLWGFMKVRYRGLAKNTARAFTLFGLANLYLVRRYLLPP |
| A0A2S6ZBC6 | 14-83 | None |
| A0A859RJF2 | 70-122 | None |
| A0A1E4VA49 | 13-87 | None |
| A0A1G6S5A5 | 10-74 | None |
| A0A1M6QAJ5 | 5-87 | None |
| A0A7C3CQX0 | 73-135 | None |
| A0A7X4IJ42 | 50-121 | None |
| A0A0E3UGP8 | 2-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.