DPCstruct | MC2559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 222 ± 26 aa |
| Standard deviation of domain lengths | 26.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6F2E3 | 3-206 | RLWRALEDAASLMEVAEVWQQRLGTEFEPLSRLFIATNKFASRVRFVGDSALWKVIEYEDRVIALNEETFEHRVLQRSNALLRRIDV… |
| A0A7C4QNR1 | 75-320 | TSLKRFWPAVESLPSLAAVEAEWLAHLRGDYHVIKPFLRPRKDRASSFPRPDGGLPYQVVEHGRNDLVGVCQETGETITLSRSQLVV… |
| R7IN02 | 12-255 | None |
| A0A6L6J3E3 | 268-491 | None |
| A0A315CSL8 | 1-270 | None |
| A0A842HE87 | 3-218 | None |
| A0A7C5N4D3 | 2-228 | None |
| A0A3A4NT00 | 1-235 | None |
| A0A1I0DJS3 | 12-211 | None |
| A0A7V3AHE3 | 3-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.