DPCstruct | MC25589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 159 ± 30 aa |
| Standard deviation of domain lengths | 29.66 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7W6H1 | 274-410 | IVEVIFSELFNLPQPRYLDIFYGSLLIELSKLQPSTMPQVLAQATEILFLRIETMNTACFDRFVSWFSYHLSNFQYRWSWEDWEECL… |
| A0A0S7GIQ4 | 9-174 | QSKPCDLPVEFSLFQVIFGELFQLPLPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCIDRFINWFSHHLSNFQ… |
| A0A813Y6I9 | 422-615 | None |
| A0A0N4T883 | 76-260 | None |
| A0A4Z2D3W5 | 371-550 | None |
| A0A812SSY8 | 345-482 | None |
| A0A3P6S9B4 | 35-150 | None |
| A0A368FXU7 | 1-169 | None |
| K8EBJ4 | 376-504 | None |
| A0A7R9AAD2 | 302-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.