DPCstruct | MC25588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 11.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 42.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0TAE4 | 32-145 | MGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQKAMDEKRFEEAIQLRGRSFENNWNIYKLLAHQKPAQEKSPFSM… |
| A0A2H2J6Z0 | 1-119 | MGYEAVQEILRTEDEDGSPLIGAKNVAKVMCLRGHNIERNDMSRVIRQIETANEETCNGSSDLACKLRGFGFLDKQTYLNFVSVPLT… |
| A0A0D8X8R0 | 257-389 | None |
| A0A2D4IYB2 | 112-225 | None |
| T1GYT0 | 177-319 | None |
| A0A183DBI6 | 41-178 | None |
| A0A6M2DYB9 | 109-227 | None |
| A0A0C2F583 | 36-175 | None |
| A0A0C9SUE2 | 358-473 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.