DPCstruct | MC25584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 184 ± 19 aa |
| Standard deviation of domain lengths | 19.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815DC49 | 113-285 | LFPLLPVAGLRVKPVLLTLYETYFLPLGNGLNSVLTGFLIGLFSSLEEGADYYNRIILLLDNLVNKTDEIYFYTCIWSAMHLVASVR… |
| A0A0S7G4J9 | 7-189 | FSSSGLFPLLGHAAMAVKPVLLTLYERYYLPLQRALLPSLQAFITGLLPGLEEGLEVYDRTDALLVKLSLLVGQQVFYGALWGSMLV… |
| A0A183KAC6 | 73-286 | None |
| A0A4U5PI76 | 137-328 | None |
| E2LYN1 | 41-199 | None |
| L5KAZ5 | 265-456 | None |
| A0A5S6PSF9 | 123-325 | None |
| A0A1I7S1B1 | 114-314 | None |
| A0A0N4TGD4 | 2-175 | None |
| A0A183HHD2 | 122-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.