DPCstruct | MC25582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 139 ± 15 aa |
| Standard deviation of domain lengths | 15.17 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183J0X6 | 1-123 | MVGDRLPNLQRYIDTHPGEKIACNGSALTIIFCENATSLDTCDPYFMNAWRMGEIRENQAITGLTSNAIKDNLFSKYLKAGGILSRN… |
| A0A0S7FW68 | 1-160 | MLGNRTLVRDGFDVCAKTEVKGNITEPSQLWNRFCVGGNLSSAQCDDYFIQNNVTEIQGIPGLGSGIIRENMWSNYLQKGEILEKAG… |
| A0A811VFM6 | 330-450 | None |
| A0A0N4WL15 | 1-149 | None |
| A0A2R7VVG8 | 53-175 | None |
| A0A183IYD3 | 120-273 | None |
| A0A4Z2G7H6 | 147-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.