DPCstruct | MC25581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 692 ± 79 aa |
| Standard deviation of domain lengths | 78.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.97 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0369- CL0036- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FT62 | 1-752 | MSAGDSHEEGRLVYRYGGEPVGAFVQPSLRPLMPAIAHAMFLDVTHDNECPIQLRSAFDSLPSSAIVSMACCATGSTRGYDEMVPHQ… |
| A0A3P7E7H1 | 2-686 | RHLVCWGDCIKLNYGEKPEDCPYLWDLMKKYTQRCAKIFHGLRIDNCHSTPIHVAEYLLKAAREIRPDIYVIAELFTQSESLDNIFV… |
| A0A3P8AVF1 | 607-1194 | None |
| A0A6A4TYA2 | 381-1218 | None |
| A0A1B0DM07 | 496-1121 | None |
| A0A1U7LJZ3 | 250-888 | None |
| A0A6I9P769 | 112-829 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.