DPCstruct | MC25580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7FSP4 | 1-110 | MIVSALLPFSALIVETEINFLLKQALTIVATLPFTYMLEEWRWQVLAGNITKDEWMKRWWEMKRELVGVVEPVPRDETYCDPPALFH… |
| A0A3Q0DQT5 | 2-89 | ALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICPPVLRNETHFDAGAKFHVPSVTPYIRYFVSFVLQFQFHQALC |
| A0A2Y9PNE9 | 2-92 | None |
| A0A4Y2ULH9 | 69-156 | None |
| A0A2G8LP82 | 130-219 | None |
| A0A7R8X5F2 | 183-286 | None |
| A0A7R8XDL7 | 488-597 | None |
| A0A7R8XF70 | 161-267 | None |
| A0A820YNP2 | 4-83 | None |
| A0A7M7HEW7 | 6-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.