DPCstruct | MC2558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 31.80 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF01219- CL0525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7R972 | 1-68 | MEWLFIITAVFLVLITEIVNSAIEYTVDLVTGDYHILARYAKDIAAAAVLFASIYAVIVGMVILIPYV |
| A0A7C4LJ49 | 6-121 | LLRSFRHAANGLWHVLRTQRNMRLHVAAAVAVLVTAWWLELDTLRWSILLLTICGVLMGEVLNTAVEGLVDLLSPQFHERAKVAKDV… |
| T2GF33 | 14-135 | None |
| A0A3D5PC93 | 2-86 | None |
| A0A517QQK0 | 28-144 | None |
| A0A7X1NK68 | 2-99 | None |
| K6Q1W8 | 11-128 | None |
| A0A7C3KQ53 | 8-124 | None |
| A0A2U3KTW0 | 47-172 | None |
| A0A2X4VYS0 | 11-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.