DPCstruct | MC25579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 11.80 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10702 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A5VIY4 | 1-107 | MSQKLYNQLIAGHQGLGAGTMRDVILPAILGKETDEMLYWIGKDLARVYPVATAEDLVYLTNQLGFGRLALRKKSNTSQVWRLSGVI… |
| F3MYJ0 | 1-108 | MAKSDYTTLLNLPGSVSFFAITAMRDLMLPNMLGEEQHHILYWAGRDLATKLPVAESALPQLFTQVGLGTLSPLKQKRQERQYLLAG… |
| A0A806TP04 | 29-112 | None |
| A0A2V3W7P9 | 1-111 | None |
| A0A1B2A221 | 1-109 | None |
| F9UQI8 | 64-163 | None |
| A0A068NBX2 | 1-96 | None |
| A0A840QMR9 | 7-86 | None |
| W8AD49 | 10-86 | None |
| A0A061N5N2 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.