DPCstruct | MC25576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 162 ± 38 aa |
| Standard deviation of domain lengths | 38.34 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9MMX8 | 1-128 | MAALAKNKWYQWYLKEVSSGRLTLPTYEQENNVIKIYYGERFCRVPDCAKAQKEYSATNNLRTHILSHETYTCPENSGGRVGTKVVD… |
| A0A6A6WNR7 | 1-208 | MSKQLTTSEPYTAYRALGCLPFGIEKFDTEDVEDSTLPGVIVKFGELYCRVELPDSFGELCGGRFDSRGALVTHIKKYHASHVAVSP… |
| A0A6A5UGB7 | 6-197 | None |
| A0A1L9V499 | 4-195 | None |
| A0A366RYH2 | 2-187 | None |
| A0A0J6YPV1 | 124-286 | None |
| A0A2K0UPC9 | 1-143 | None |
| A0A6A5S1H1 | 9-202 | None |
| A0A093WZR5 | 6-217 | None |
| A0A319D6F9 | 41-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.