DPCstruct | MC25575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 171 ± 10 aa |
| Standard deviation of domain lengths | 10.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1FQU0 | 78-257 | VCDVVVDGDDMCGKTFGQQPALRRHIRQKHPGAIDPVDDRSNLDDSESIPGNNALKLWIRSGGWRRAGYVHEPGRGSHKMNKMCDTI… |
| A0A5M9MI94 | 1-174 | MVCNIAVNGNQMCGQPVRSQIALRRHIRNAHPGATLNPFCTNIPQAERIAGENALKQWILSRGWRTACYVKEPGEGPMYSIIQDCCN… |
| A0A1V6TU68 | 96-271 | None |
| A0A1Y2DE99 | 78-253 | None |
| A0A1V6RQ44 | 1-168 | None |
| G0S3F4 | 94-268 | None |
| A0A1V6R065 | 1-156 | None |
| S8B9Z5 | 94-271 | None |
| A0A0G4PBB7 | 80-261 | None |
| A0A5M9MLR2 | 70-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.