DPCstruct | MC2557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 209 ± 33 aa |
| Standard deviation of domain lengths | 32.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01311 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2JXV5 | 29-228 | ARQSAAALPQNLVGYAAVAIGELLLGLLLGLGVAAILAGLQIAGQIVDQQAGFGLGSIINPELDSTGSVSGQALSFLGLTAFLLMEP… |
| A0A7X2FQV8 | 23-253 | TAIMLMPGFGDIYVSPRIRLALVMMIALILTPVIGPILPPEPAAPAALLKIVASEVFVGAFLGGLIRVLVGTLTTAGTVIAYHAGAA… |
| A0A847NLT5 | 3-160 | None |
| A0A7U9BAX7 | 2-183 | None |
| A0A3S4II23 | 15-177 | None |
| T0CRA7 | 30-226 | None |
| A0A090NVI4 | 27-255 | None |
| A0A7V0V9B9 | 2-168 | None |
| A0A7W1A0C7 | 3-212 | None |
| A0A135L343 | 14-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.