DPCstruct | MC25569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 137 ± 25 aa |
| Standard deviation of domain lengths | 24.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1GRR9 | 79-220 | AHMGKGLGNRFLDDLRHADALVHVVDRCLDKLQIKEPLQDWSNETIERVVHAFTDEKFPTVIALNKIDHPDADKNIAKIAKQQDPKT… |
| A0A421JI74 | 74-226 | MERWGSVVRRHVATKSSTLETLRQQLGGYSANKQLIGRALDLMPNLPPLQDWDNETIEKVVKSFMAVKFPTVLSLNKMDHPDADKNV… |
| D4AZY9 | 50-169 | None |
| A0A4V5NIS2 | 16-168 | None |
| A0A2G5B2V4 | 126-223 | None |
| A0A225ASB8 | 610-767 | None |
| A0A7S1SVY3 | 22-160 | None |
| A0A7C2Z2C2 | 3-87 | None |
| A0A444RX26 | 903-1052 | None |
| A0A831WPN9 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.