DPCstruct | MC25568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 176 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z7LY21 | 157-371 | DNDSNYSKARLINNKGEIKDFSKFGLNKMDQLAIIRLLLKNKEELDDLTIEDYFSESFLKSNFWTFWRTMFAFENWHSLLELKLYMH… |
| A0A4S3JWC3 | 12-156 | SPPDDIDTWILVWDCEAHSAFSHGIAPWNSVVASVTHDLHGLNHPRSLDRGPFNRHEAITVPVVQFLQSQESDFQFHTTVTDILLYP… |
| A0A1L9VPS8 | 36-254 | None |
| E4HLF3 | 4-123 | None |
| A0A0A2KQU0 | 114-299 | None |
| U6F3L0 | 79-257 | None |
| A0A395HXH4 | 18-201 | None |
| A0A399H2W9 | 132-293 | None |
| A0A094I7Y0 | 206-360 | None |
| T0E1B7 | 7-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.