DPCstruct | MC25564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 112 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1AXY5 | 1-109 | MNIKEANLVRWKELPYEYGKQFLSNRYMEKFNNPRVFYVGVNYKVHSQNEYFIDGVNYFLIAMVLEDGMWKIALAPHVPVQSIISAG… |
| R4KKY3 | 105-206 | SIKDAKLLSLKQLPIEAGTDYGAEATDYISEYGDACLYYVALDLKVRNESKYFINGANYLLVLLVPESDQWKIALMPKAPVGVLNQD… |
| C2ZCC5 | 44-152 | None |
| A0A1F8UZS8 | 116-239 | None |
| A0A1F8V4M6 | 133-240 | None |
| L0IGK3 | 92-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.