DPCstruct | MC25563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 588 ± 72 aa |
| Standard deviation of domain lengths | 71.94 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 20.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P1AR91 | 1-755 | MKKISTRIPTLLIMMVMILSMSSSLAFAYDGNITAVGTDTDNDLKASMQNANLLPSPTNVDERAARGNYLPYTGYFEESFTDGAAAG… |
| A0A1C5UV95 | 346-886 | TVTLTQASHNRYDYNALEDGYTTDYSSIMSPQYYVYAGNVNKEEAETLLDQMKIADNLHEWAATIHVITPLNNDQYTQKDADSFIDL… |
| A0A412BDC0 | 2-518 | None |
| G9R3A9 | 360-869 | None |
| A0A1P8JS81 | 1-679 | None |
| A0A1V6E023 | 598-1167 | None |
| A0A852UBK3 | 1-567 | None |
| A0A4R4RL54 | 6-543 | None |
| A0A417GKI3 | 315-907 | None |
| G7MDB6 | 576-1128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.