DPCstruct | MC25560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 130 |
|---|---|
| Mean domain length (aa) | 141 ± 31 aa |
| Standard deviation of domain lengths | 31.40 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00162 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8HS41 | 21-144 | DSFSESAETKVVPIDQIPADWEALDIGPETQAKYAEVIAKSRLVVWNGPMGVFEFDLFANGTKAVAQALAGTEGYTVIGGGDSAAAV… |
| A0A354EKZ4 | 118-233 | QFDSKVILPIDFANDGRLDIGEKTIEKFCEIISHAETVVWNGPMGLFEKKPYDNGTRKILQAIAESGAFSVIGGGESVQAVNESNLE… |
| A0A0G0CIW9 | 716-826 | None |
| A0A0G1UZ41 | 64-168 | None |
| A0A835HCX6 | 169-352 | None |
| A0A2C9K4E8 | 461-553 | None |
| A0A2W5KBQ1 | 87-223 | None |
| A0A534IEL3 | 1-72 | None |
| A0A446ISN8 | 8-119 | None |
| A0A1C3YN26 | 385-530 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.