DPCstruct | MC2556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 140 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 24.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5S5E0 | 54-186 | QLLIKAVVDFIGRNVRMGASAANVVNTTVYPQLFFVNLQLVEDCTRRVSLLEPYWRFEGKQPSEQLGEIIEKKHDIVGAFIERSFFF… |
| C5WIE2 | 93-227 | KEIELTNLVNECEHKLFLYNQSMTIVNDTTNPDTFFNNLDTAKYSLERAVEISKYDFINASGDDLEKGLERLTNEKLNIEEEFVKRY… |
| A0A844FI42 | 11-139 | None |
| A0A1Y3TZY8 | 100-237 | None |
| A0A417HNW0 | 117-243 | None |
| A0A2A7AIG1 | 160-296 | None |
| A0A6L5YP14 | 163-288 | None |
| U2UP18 | 2-141 | None |
| A0A413K8I2 | 8-192 | None |
| A0A316PY92 | 12-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.