DPCstruct | MC25559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 398 ± 91 aa |
| Standard deviation of domain lengths | 91.38 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7PFY9 | 2-215 | VYRVWKNPEGQLSWLNNALKNPDIFCFADFTCRRTATECLKAQPEEENRLISSWRSLNLIETLLNLSETGVYSSCVELFKFPLTQCP… |
| A0A182SYK1 | 193-603 | LDDCRNHLLKVGGREITPQDVAKIVSSMCLTHETLSESNINLQTPSAFWPQGSSDPSGQKSKDGNGGSSASENTTWKPEVLVQALKE… |
| A0A251S102 | 2-308 | None |
| A0A4D9A7B5 | 52-440 | None |
| G0R1C2 | 28-460 | None |
| A0A0S7JDY7 | 51-377 | None |
| A0A0S7JDZ7 | 6-433 | None |
| A0A4Z1IT97 | 175-732 | None |
| A0A0F7S8C7 | 87-527 | None |
| A0A446IZM3 | 249-698 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.