DPCstruct | MC25556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 201 ± 13 aa |
| Standard deviation of domain lengths | 13.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.98 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF14744- PF14746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4HB68 | 213-417 | RHFADKVLQLSPIDDHLPNQIIDQGIDVLQIMRNIHTFASSYAYNMNLQIFVEMQSKSKHLDIIGTRHVANSVQTHGTGIINTTVNF… |
| A0A182STT4 | 2-238 | RAIVDRKYGIRLVEDQLPRTTAEDRRGPRGHGQDDDVLALMEDFETFIGSYGYDLHGQLFIERQQAAAAASGGGGSGGGPSSSGVLN… |
| A0A2H2JD85 | 1-202 | None |
| K1PKW3 | 903-1108 | None |
| A4I0W7 | 987-1188 | None |
| A0A5N5SSL7 | 593-805 | None |
| A0A817Z8E5 | 342-534 | None |
| A0A329R7Z2 | 1-201 | None |
| A0A2D8AM95 | 3-227 | None |
| A0A6P4JX78 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.