DPCstruct | MC25554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 300 ± 40 aa |
| Standard deviation of domain lengths | 39.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182SRX6 | 3-278 | DPEFIKRQDQKRSDLDEQLKEYINEWRKQRAKEEDELKKLKEKQAKRKVSRAEEEQRMAQRKKEEEERRVREIEEKKQREIDEKRKR… |
| A0A044R196 | 65-396 | TEAEMAMLAAKKRHQEEEAAKIQDYEERRQIEREKIEEELRALKEKQDQRRQQRAQEEREFAERQREIEEKRRQEEEASKARIEAEK… |
| A0A158QVV9 | 17-278 | None |
| A0A6H5INU6 | 218-545 | None |
| A0A183UTX9 | 1-367 | None |
| W2SZZ2 | 21-309 | None |
| A0A0B2VC98 | 87-459 | None |
| E2BCA9 | 2-269 | None |
| A0A023EPH6 | 29-306 | None |
| T1H283 | 1-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.