DPCstruct | MC25551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 238 ± 36 aa |
| Standard deviation of domain lengths | 36.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1BST8 | 160-418 | MALMLHQKAKTFIKRDMHKEALDVLVMAEEAFSLCDPKLIERVDNVPMLQLDIVWCYFVLRDVSCLEVAGTRLEKARSGFERSHGKD… |
| A0A182SK37 | 2-236 | ALTLYEKGKAAMKAGNYEEALLLLLEADHDFRACNSQLLNVVDNYALLNLDIVWCYLCLKNLNQLPDAEQRLKVCELKFQQSYGKNM… |
| A0A6F9CMU1 | 648-915 | None |
| F7AZ69 | 233-488 | None |
| A0A553MQ82 | 145-387 | None |
| A0A2K6ST87 | 140-432 | None |
| D8LR71 | 429-668 | None |
| A0A4Y1RX86 | 426-712 | None |
| A0A820WD78 | 225-441 | None |
| A0A6P5XKT7 | 66-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.