DPCstruct | MC25550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 541 ± 61 aa |
| Standard deviation of domain lengths | 60.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 71.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1QJC8 | 1-463 | IAYLLDVKIDVQPSQSETQGVSIKQVCFLVRELLTIFENEPSECFVKDLIHLLPKICSKLDDVVSRLRQDDNCNFRKGAILLLHLLT… |
| A0A182SJY9 | 1-595 | MLERMITDSEYIPPLASDLMDPPIAASKKLKFAEAQRASRPKAGSHDKTVNLDAPLSTQTAAATAPSTVGQFNEQSLLLRCGFALRR… |
| I0Z3T3 | 414-1024 | None |
| E5QCJ4 | 1-495 | None |
| A0A0K0E3Z8 | 940-1491 | None |
| A0A7J7NK00 | 418-1023 | None |
| A0A0L7RFZ4 | 557-1023 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.