DPCstruct | MC25549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 60 ± 8 aa |
| Standard deviation of domain lengths | 7.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K7HI38 | 109-157 | FKSAFMRDILKGLQYLHKSPVGYHGYLQASTCLIDINWVLKLTLYGVSN |
| A0A8B6EFF9 | 374-431 | FKVSLLTDLVRGLRFIQNSAVRYHGNLKSRNCVIDSRWVLKLTDFGLKEKFRANIEPE |
| A0A833VPT3 | 49-106 | None |
| F4W972 | 743-813 | None |
| A0A815X1C5 | 43-100 | None |
| A0A4Y2CL75 | 252-322 | None |
| A0A0D8XRG8 | 542-610 | None |
| A0A6V7U471 | 822-891 | None |
| A0A1X2GAX9 | 922-986 | None |
| A0A4W5KCP4 | 402-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.