DPCstruct | MC25547
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446JTA2 | 71-164 | LRLLLQLLLFEDFRMELAGSAADALLPLLFCEQELYQRLVHELLEKEQNPTVKSRLALAFHNLTSSNNLSSTLDRPNRQKFRKNLRV… |
| A0A182SIM7 | 17-118 | LSTMMNIVMFEDCKHHWSMSRPLLVLILLYEDCFRRIRETLIQSQPVAKQQNMARLFELLMDGIERNLLIQNRDKFTQNLLQFRRDM… |
| A0A6I9XIM8 | 817-920 | None |
| A0A1I7VTN3 | 2-108 | None |
| A0A183HLM9 | 83-178 | None |
| A0A1R0H3R1 | 183-289 | None |
| A0A1Y1UZR5 | 477-596 | None |
| A0A5N5TDM4 | 2-94 | None |
| A0A2Z6RIG2 | 7-119 | None |
| A0A7J6CMI3 | 2-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.