DPCstruct | MC25546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 346 ± 55 aa |
| Standard deviation of domain lengths | 54.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5Y7J1 | 1-291 | MRSLVFLLLVALASAKVYERCEWARVLKAHGMDGYYRTSLADWVCLSKWESSWTTTSTNHNTDGSTDYGIFQINSRWWCEDGRTPHS… |
| A0A182SI32 | 16-409 | SAPAGETIRIWTRCEVARELALKHVPEEQIGDWLCIAEQGAAYNGSAVNLRFKQFGGSGYYGLFQIIDRYACAKYGSICVVRVQAYF… |
| A0A139WK39 | 108-372 | None |
| A0A0J9UGH7 | 8-350 | None |
| A0A6J2UCN1 | 2-435 | None |
| A0A6P7FH48 | 6-447 | None |
| A0A1A9VFF1 | 303-624 | None |
| C8C412 | 1-287 | None |
| A0A1A9WIY7 | 24-387 | None |
| A0A0L0C723 | 5-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.