DPCstruct | MC25545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01267 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7P5H6 | 46-120 | DHQEELSDDQKKEIAKWFLINSPAGEIQYVAKDVRTVISDDSVYDLAASEAFPQYNKTHMISLELPNRSGDVVYV |
| A0A182SFN9 | 1-92 | MADVDDVISDQDKIRIASDFLMHAPPGEFNEVFNDVRELLNDDRLLKEGASAACAQYNKDQLTPVILENSEIAVLVTEFNDLGKWCA… |
| A0A0F7SSZ8 | 1-79 | None |
| A0A0D3AFH6 | 1-87 | None |
| A0A5B6VT92 | 2-83 | None |
| A0A834QBS9 | 1-84 | None |
| A0A1Y1WHE0 | 4-73 | None |
| A0A820X8U7 | 2-79 | None |
| A0A146H2P0 | 137-214 | None |
| A0A5J4P0V0 | 2-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.