DPCstruct | MC25544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 435 ± 116 aa |
| Standard deviation of domain lengths | 116.33 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 73.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 25.21 |
| Pfam Score | 70.00 |
| Assigned Pfam label(s) | CL0023- PF01422- PF01424- PF20173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9KEE9 | 6-372 | DLWSKILDDMEQRGCVGKSLPLACQNHPTTITNVSNDYDFNKAPNGGCNVLCGTRLVCGHRCEQLCHPTDPNHEEYDCRKPCPKTCE… |
| A0A182SCQ3 | 35-460 | MQSIWSCGNCYHILHLACVTKWATSSQAEDGSGWRCPACQHVTKKIPREYYCFCGKQKNPAYSREDLAHSCGDVCGRRENCDHACTL… |
| A0A7J8JZM2 | 144-685 | None |
| A0A0M8MYU6 | 46-629 | None |
| A0A7M7N432 | 9-378 | None |
| A0A7J6L108 | 374-890 | None |
| A0A158R180 | 408-728 | None |
| A0A2A2KL97 | 35-586 | None |
| A0A1D6FEF4 | 20-356 | None |
| A0A2I1E534 | 280-679 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.