DPCstruct | MC25541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 9.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TX88 | 8-98 | LEFLFFKPGDAFAVAATEGVFVYSLEKAGLGSSLLGGVSNWLFDAVAVDEDTTPSNARLQLSQGNLSTALDIALRLQMHDLIEEIIE… |
| A0A1E3HM88 | 668-767 | STLPGASKGDLSKRRYRRDARTNCVRFSATGRSWAAASTEGLLIYSLDESTTFDPFDLSLDLTPESTLQTAAQGDYLIALIMALRLN… |
| A0A177AV75 | 1029-1137 | None |
| A0A448WIY3 | 2-130 | None |
| A0A5A8C6V1 | 893-992 | None |
| A0A4Y9Y0W1 | 643-742 | None |
| M1V776 | 753-842 | None |
| A0A0K0EKR2 | 646-753 | None |
| A0A3R7E8J4 | 636-731 | None |
| A0A2H1CHM8 | 43-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.