DPCstruct | MC25538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 332 ± 44 aa |
| Standard deviation of domain lengths | 43.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6J373 | 50-414 | RPTVQRVETPGRPRGAVAREQAMSATYGIRIGPGPGGGAHFTNAMLDQIDAALRELPLSDLRDNEHLLAIEMDDNQDGSTSEYREDQ… |
| A0A519ZK28 | 218-499 | VLAAMAARFGLEAAVSEGSGASAASMKELCRLYQVMTRVPDTHTKDNPSLKKVTRKATPGSAYGSGEITMGEGHPDASASYRVGATT… |
| A0A0F2RQM9 | 665-964 | None |
| A0A7W0ZYC2 | 887-1227 | None |
| A0A7W0Y5T6 | 8-296 | None |
| A0A556MYL6 | 391-689 | None |
| A0A538Q969 | 121-440 | None |
| A0A5C7A5U2 | 33-470 | None |
| A0A2P2GQL2 | 12-363 | None |
| A0A7W0VSH8 | 705-1022 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.