DPCstruct | MC25535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 84 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 90.91 |
| Assigned Pfam label(s) | PF04296- PF17068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2A7S0 | 2-84 | EPVRTCIGSRRRAPRSSLLRVVALSDGRVVADPKAVMPGRGAWLTPTVEAHDQAVKRRAYRRALRLDREPDTSAVRDYLEALS |
| A0A2S0KLJ9 | 4-84 | KHIPTRMCIACREMRERQELFKLVKIDTGIVVDHLYKMDGRGTYICKDENCIKLAFAKGMLKRSLKAEVDPSLETELLDFI |
| A0A7C1GDH8 | 23-101 | None |
| A0A832B359 | 2-78 | None |
| K8F2W4 | 56-164 | None |
| A0A538Q8X3 | 2-73 | None |
| A0A516H0E3 | 27-121 | None |
| A0A212DMT5 | 3-74 | None |
| A0A7T6AQA1 | 1-64 | None |
| A0A522N1L9 | 64-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.