DPCstruct | MC25534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 10 aa |
| Standard deviation of domain lengths | 10.08 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U8URD7 | 392-449 | KPINIPDRADWHKYEMDCTREEDGFGKRCEDWSDAGLCSTNAATRFLWCRRTCLCVGP |
| A0A0K0DKW7 | 1-66 | LRESYQLEIFSSSTISRTPYQWNCDNEIDDKGKLCKGWAEGGLCTMHKATMFLFCRKTCLCVGPSV |
| A0A0N5ANL8 | 645-719 | None |
| A0A183FE68 | 2-53 | None |
| A0A1I7U5E8 | 240-312 | None |
| A0A0N4XU21 | 1-49 | None |
| A0A0N5CZT7 | 1-59 | None |
| A0A0N4UJ16 | 9-74 | None |
| A0A3P6IF05 | 30-109 | None |
| W2TGI4 | 60-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.