DPCstruct | MC25533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 404 ± 52 aa |
| Standard deviation of domain lengths | 52.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08621 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0DJW7 | 8-373 | RKLLYRYLESLDEEKINELRQEIAEKLAPDKIDFLKHRYQMKKETTEAKPKVSKYKASRESKFEPHQPSSLVSSTVPSTTVLKDIVD… |
| A0A2A2JP27 | 39-463 | LDPKTIQFLLEKRKRTEQSGQSTEPVKISKFKRQKLETQNLEKQVEATKNEPQKLVQFKDDEIPKEEPPSNEVVAEMIKQLEVLDEF… |
| H3E106 | 771-1209 | None |
| A0A2G5UC57 | 193-563 | None |
| A0A2G5UBR5 | 517-887 | None |
| A0A0N4WAK9 | 25-393 | None |
| A0A6V7U4L0 | 151-581 | None |
| A0A368GKH5 | 415-783 | None |
| A0A7E4VA40 | 121-528 | None |
| A0A6G0UWR5 | 625-1104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.