DPCstruct | MC25530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 161 ± 22 aa |
| Standard deviation of domain lengths | 21.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0DA42 | 8-160 | SAAVSTIQLQSFEKGLRSPSLGEQLATVVSTASLVKANPFPMYVNTIVVRLADAFKDGSNPLRMTIARVLSECDSHLSLVFSGSEIF… |
| A0A6V7TMM3 | 2-163 | ESHKLHTMQLHVEKGLQSSNLADVMTTITECARYIREYPFPHFVHATLFRLAQTFNGEIFARKFEHSMNTIRLRIVVAIKECNECLS… |
| A0A433Q4G3 | 25-200 | None |
| A0A287K6A3 | 25-208 | None |
| A0A2H9TNW1 | 4-149 | None |
| A0A4W5NXG1 | 1-133 | None |
| A0A2P2MFA8 | 5-184 | None |
| A0A821LZB6 | 570-714 | None |
| B7EZ59 | 6-198 | None |
| A0A3P7JRX9 | 7-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.