DPCstruct | MC2553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A858R5N5 | 1-114 | MREMRSISFSEQEAIRAVIELMQRQRQPLPKGRVLRLELREDPVGASLVVEDDYGAVSHVQRNAAELTASLVSYCIDRRIRLPNRGR… |
| A0A501PB05 | 1-118 | MAAEVRHIFFEESELIRALMKYSLVKKQPIEFGDIKGLIVNNAGSVSATLMVKKISNEPPVKIEFPMPELAAALMLFCRETGIVLPR… |
| A0A651FMN6 | 2-140 | None |
| A0A1V2GWN4 | 129-232 | None |
| A0A437MNM4 | 20-127 | None |
| A8TSQ6 | 1-109 | None |
| A0A564WA87 | 6-116 | None |
| A0A512H683 | 1-124 | None |
| A0A1Y6CMQ2 | 1-117 | None |
| A0A541C069 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.